PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim06g069760.0.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family Dof
Protein Properties Length: 493aa    MW: 53491.7 Da    PI: 6.5082
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim06g069760.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof1161.5e-36140199261
              zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                         ++k+l+cprC+s +tkfCyynn +++qPr+fC++C+ryWt+GG++rn+PvG+grrknk+ 
  Sopim06g069760.0.1 140 PDKILPCPRCNSLDTKFCYYNNNNVNQPRHFCRSCQRYWTAGGTMRNLPVGAGRRKNKNL 199
                         7899*****************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-28137197IPR003851Zinc finger, Dof-type
PfamPF027017.2E-31142198IPR003851Zinc finger, Dof-type
PROSITE profilePS5088427.773144198IPR003851Zinc finger, Dof-type
PROSITE patternPS013610146182IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 493 aa     Download sequence    Send to blast
MTCDSEIKLF GKILPVVVSG VGRGLSGSDG VIYDGNRNGS DLDRCLEGSK ASSVEKDEGS  60
EYEKQEAEKD NITGELSEAK SEEGDQNQMI EESENPKTPS ESESSPKSST EEDPQAVKSS  120
KTENEPTNVT NSEQNNLKKP DKILPCPRCN SLDTKFCYYN NNNVNQPRHF CRSCQRYWTA  180
GGTMRNLPVG AGRRKNKNLA SQYRNISIPE GLLAAGIESP NGLIHHPLFK PNGTILSFGP  240
DLPLCEPMAS ALNQAEKRVS TGIQNGSHKS EVKNSSCKGG DSGDECCRGI NIPTPNMMVE  300
EGKGEPHKAV MHSINGIPSP VPCLHGVPWP FPWNAAVPVS AICPIPFPMP FFPTPYWNCS  360
VPPWSNPWLS PPLRAANEKT SGSDPTSSLG KHSREGDLLK PSNPGGKEQS EQKYSEGSIL  420
VPKTLRIDDP DEAAKSSIWS TLGIKYDSTN RGEFFKALQP KSNDKHNKAN TFPVLHTNPA  480
ALSRSITFQQ GA*
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755180.0HG975518.1 Solanum lycopersicum chromosome ch06, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004241585.10.0PREDICTED: cyclic dof factor 1
TrEMBLK4C8E80.0K4C8E8_SOLLC; Uncharacterized protein
STRINGSolyc06g069760.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA53224122
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47500.11e-76cycling DOF factor 3